PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco011844.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family WOX
Protein Properties Length: 208aa    MW: 23006.9 Da    PI: 10.5404
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco011844.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox56.54.9e-182383257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
     Homeobox  2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                 rkR+t+ ++ql++L+  F k    p+++e++e+A +l     ++e++V++WFqNrRa++++
  Aco011844.1 23 RKRWTPLPKQLNALQGIFDKcRGVPNRKEIKEIALQLsqhgPISEANVSNWFQNRRARMRR 83
                 8******************96678***************999*****************97 PP

2Wus_type_Homeobox76.15.1e-252283263
  Wus_type_Homeobox  2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerq 63
                       ar+RWtP p+Q++ L+ ++++    Pn++ei++i+ +L+++G i+++NV +WFQNr+aR r+
        Aco011844.1 22 ARKRWTPLPKQLNALQGIFDKCRGVPNRKEIKEIALQLSQHGPISEANVSNWFQNRRARMRR 83
                       689*********************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.3E-131886IPR009057Homeodomain-like
PROSITE profilePS5007113.7831984IPR001356Homeobox domain
SMARTSM003891.1E-132188IPR001356Homeobox domain
SuperFamilySSF466891.67E-152186IPR009057Homeodomain-like
CDDcd000867.71E-142385No hitNo description
PfamPF000468.6E-162383IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 208 aa     Download sequence    Send to blast
MLTGTPNYSD SPTKSGVHKI PARKRWTPLP KQLNALQGIF DKCRGVPNRK EIKEIALQLS  60
QHGPISEANV SNWFQNRRAR MRRSHADISH NSGAEPRTGT SKINCSLYRT PRMDQWMVRT  120
AHVANQEAGS GVGSYYQSND SLNYFAGIAR QNLLQQNGLS GSGSGTCSLK IFRFCELTAF  180
SPRRSFATIV VTWDALDHVF AFSDSAS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.11e-23WUSCHEL related homeobox 13